PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc004349.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family FAR1
Protein Properties Length: 814aa    MW: 91407.8 Da    PI: 8.2962
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc004349.1_g00001.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR1225.3e-076887294990
                     FAR1  49 ekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                               + +r+r+++r+gC+ak+ +k++ dg + v ++e  H+H+l+
  Itr_sc004349.1_g00001.1 688 ISPKRRRVTNRVGCNAKIILKRMGDGWYFVFSIEIRHTHSLC 729
                              4568999**********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF134561.3E-7594654No hitNo description
PfamPF031019.4E-5686729IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 814 aa     Download sequence    Send to blast
MERDFGLGSR EVGSGLGVRG RVVVAAWEGF EGLDVVERLA KCGQAVWNWG KKQSSEVDRE  60
LKGCEERMRR LRGARGEVRV REFGAVQCHF FVLLKSQCSR WRQRANEMWR RNRIRGLQGS  120
VGAMVTNAAS MGKIMIDYFL DLFAAKGGNM RPVQDCVERR ISPEHNDELL CPISHDEVRK  180
AIFSMHPDKS PGLDGLSPTF FQMHWDFLGD EEREEGIHGM YVARNAPSIS HLFFADDCLF  240
FFRANNFEAG VLKEVLAEYG CASGQLVNYD KTSIVFCRNV HREDKEAVCE VLGFANSRVG  300
GKDVTLGVID SYLGLGGRSY LKRFFRGGGR KEIRWGTWGD LCKPKKYGGM GFRRVREMNR  360
AMLGKQGWKF LTKPDALVTR VFKAWYFPHC SFLEAGIGDG STVRVWGDAW LPDSDNSCIA  420
TSKPDYLGNP LVASLFHTHD REWDVELVRD VFNQRDCEQI LSVPVTTGLR GDSMFWGWEE  480
CGMYTVKSAY RLIMEVANGQ SVVCWAGVVT DRLCPLCGVE PETAIHLFAN CSFSHSCWNE  540
IDRDCGVPRS AVWSPPPAGC YKLNIDVAMD IYARQIGFGW VLRDEDGLWG CDSRVILETD  600
AQIVTRAVCG EKTNTLVRAI VDDIKKLLLD LPLVEFRLVK RSANTLAHVS AKNALCIAGG  660
SFVDYSNCFK QPAKDVCPVG EGVSESSISP KRRRVTNRVG CNAKIILKRM GDGWYFVFSI  720
EIRHTHSLCS ELAKPFMRVN RKLSVGHQSF VANCARVNIG PIKSFKLYKQ MVGDFVDVGA  780
TGVDFQNFKR DLMAYISGGD AXALTMMWMT GMRV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1690694KRRRV
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA338